Splicing Factor 1 antibody (C-Term)
-
- Target See all Splicing Factor 1 (SF1) Antibodies
- Splicing Factor 1 (SF1)
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Splicing Factor 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SF1 antibody was raised against the C terminal of SF1
- Purification
- Affinity purified
- Immunogen
- SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW
- Top Product
- Discover our top product SF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SF1 Blocking Peptide, catalog no. 33R-1432, is also available for use as a blocking control in assays to test for specificity of this SF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Splicing Factor 1 (SF1)
- Alternative Name
- SF1 (SF1 Products)
- Synonyms
- BBP antibody, D11S636 antibody, MBBP antibody, ZCCHC25 antibody, ZFM1 antibody, ZNF162 antibody, BB094781 antibody, CW17R antibody, MZFM antibody, WBP4 antibody, Zfp162 antibody, CG5836 antibody, Dmel\\CG5836 antibody, cg5836 antibody, dSF1 antibody, p70 antibody, SF1 antibody, sf1 antibody, wu:fc09f06 antibody, znf162 antibody, MWD22.25 antibody, MWD22_25 antibody, SF-1 antibody, splicing factor 1 antibody, Splicing factor 1 antibody, splicing factor-like protein antibody, nuclear receptor subfamily 5 group A member 1 antibody, splicing factor 1 S homeolog antibody, SF1 antibody, Sf1 antibody, sf1 antibody, AT5G51300 antibody, NR5A1 antibody, sf1.S antibody
- Background
- SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.
- Molecular Weight
- 69 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location
-