Splicing Factor 1 antibody (C-Term)

Catalog No. ABIN633561

Product Details anti-Splicing Factor 1 Antibody

Target: Splicing Factor 1 (SF1)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Splicing Factor 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SF1 antibody was raised against the C terminal of SF1

Purification: Affinity purified

Immunogen: SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF1 Blocking Peptide, catalog no. 33R-1432, is also available for use as a blocking control in assays to test for specificity of this SF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Splicing Factor 1

Target: Splicing Factor 1 (SF1)

Alternative Name: SF1 (SF1 Products)

Synonyms: BBP antibody, D11S636 antibody, MBBP antibody, ZCCHC25 antibody, ZFM1 antibody, ZNF162 antibody, BB094781 antibody, CW17R antibody, MZFM antibody, WBP4 antibody, Zfp162 antibody, CG5836 antibody, Dmel\\CG5836 antibody, cg5836 antibody, dSF1 antibody, p70 antibody, SF1 antibody, sf1 antibody, wu:fc09f06 antibody, znf162 antibody, MWD22.25 antibody, MWD22_25 antibody, SF-1 antibody, splicing factor 1 antibody, Splicing factor 1 antibody, splicing factor-like protein antibody, nuclear receptor subfamily 5 group A member 1 antibody, splicing factor 1 S homeolog antibody, SF1 antibody, Sf1 antibody, sf1 antibody, AT5G51300 antibody, NR5A1 antibody, sf1.S antibody

Background: SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location