CIRBP antibody (N-Term)
-
- Target See all CIRBP Antibodies
- CIRBP (Cold Inducible RNA Binding Protein (CIRBP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CIRBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CIRBP antibody was raised against the N terminal of CIRBP
- Purification
- Affinity purified
- Immunogen
- CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG
- Top Product
- Discover our top product CIRBP Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CIRBP Blocking Peptide, catalog no. 33R-5739, is also available for use as a blocking control in assays to test for specificity of this CIRBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIRBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CIRBP (Cold Inducible RNA Binding Protein (CIRBP))
- Alternative Name
- CIRBP (CIRBP Products)
- Synonyms
- CIRP antibody, Cirp antibody, R74941 antibody, Xcirp antibody, cirbp antibody, cirbp-a antibody, cirbp2 antibody, cirp antibody, cirp1 antibody, cirp2 antibody, xcirp2 antibody, XCIRP antibody, XCIRP-1 antibody, cirbp-b antibody, cirp-1 antibody, APBP-1 antibody, zgc:136559 antibody, CIRBP antibody, A18 hnRNP antibody, cold inducible RNA binding protein antibody, cold-inducible RNA-binding protein antibody, cold inducible RNA binding protein S homeolog antibody, cold inducible RNA binding protein L homeolog antibody, cold inducible RNA binding protein b antibody, CIRBP antibody, EDI_107320 antibody, Cirbp antibody, cirbp.S antibody, cirbp.L antibody, cirbp antibody, cirbpb antibody
- Background
- CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-