EIF1AX antibody (Middle Region)
-
- Target See all EIF1AX Antibodies
- EIF1AX (Eukaryotic Translation Initiation Factor 1A, X-Linked (EIF1AX))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF1AX antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF1 AX antibody was raised against the middle region of EIF1 X
- Purification
- Affinity purified
- Immunogen
- EIF1 AX antibody was raised using the middle region of EIF1 X corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD
- Top Product
- Discover our top product EIF1AX Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF1AX Blocking Peptide, catalog no. 33R-4747, is also available for use as a blocking control in assays to test for specificity of this EIF1AX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 X antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF1AX (Eukaryotic Translation Initiation Factor 1A, X-Linked (EIF1AX))
- Alternative Name
- EIF1AX (EIF1AX Products)
- Synonyms
- Eif1ay antibody, RGD1560198 antibody, 1500010B24Rik antibody, AI426898 antibody, EIF1A antibody, EIF1AP1 antibody, EIF4C antibody, eIF-1A antibody, eIF-4C antibody, eif-1a antibody, eif-4c antibody, eif1a antibody, eif1ap1 antibody, eif1ax antibody, eif4c antibody, zgc:101670 antibody, EIF1AY antibody, eukaryotic translation initiation factor 1A, X-linked antibody, eukaryotic translation initiation factor 1A, X-linked S homeolog antibody, eukaryotic translation initiation factor 1A, X-linked, a antibody, Eif1ax antibody, EIF1AX antibody, eif1ax.S antibody, eif1axa antibody
- Background
- This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.
- Molecular Weight
- 16 kDa (MW of target protein)
-