TRPM3 antibody (N-Term)
-
- Target See all TRPM3 Antibodies
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPM3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPM3 antibody was raised against the N terminal of TRPM3
- Purification
- Affinity purified
- Immunogen
- TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL
- Top Product
- Discover our top product TRPM3 Primary Antibody
-
-
- Application Notes
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPM3 Blocking Peptide, catalog no. 33R-8112, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
- Alternative Name
- TRPM3 (TRPM3 Products)
- Synonyms
- GON-2 antibody, LTRPC3 antibody, MLSN2 antibody, 6330504P12Rik antibody, 9330180E14 antibody, AU018608 antibody, B930001P07Rik antibody, si:dkey-201c13.4 antibody, trpm6 antibody, transient receptor potential cation channel subfamily M member 3 antibody, transient receptor potential cation channel, subfamily M, member 3 antibody, TRPM3 antibody, Trpm3 antibody, trpm3 antibody
- Background
- TRPM3 belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molecular Weight
- 25 kDa (MW of target protein)
-