CCT8L2 antibody

Catalog No. ABIN633635

Product Details anti-CCT8L2 Antibody

Target: CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCT8L2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CCT8 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCT8L2 Blocking Peptide, catalog no. 33R-1202, is also available for use as a blocking control in assays to test for specificity of this CCT8L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCT8L2

Target: CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))

Alternative Name: CCT8L2 (CCT8L2 Products)

Synonyms: CESK1 antibody, chaperonin containing TCP1 subunit 8 like 2 antibody, CCT8L2 antibody

Background: CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.

Molecular Weight: 59 kDa (MW of target protein)