P2RX6 antibody (N-Term)

Catalog No. ABIN633714

Product Details anti-P2RX6 Antibody

Target: P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RX6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P2 RXL1 antibody was raised against the N terminal of P2 XL1

Purification: Affinity purified

Immunogen: P2 RXL1 antibody was raised using the N terminal of P2 XL1 corresponding to a region with amino acids ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RXL1 Blocking Peptide, catalog no. 33R-2688, is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 XL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RX6

Target: P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))

Alternative Name: P2RXL1 (P2RX6 Products)

Synonyms: P2RXL1 antibody, P2X6 antibody, P2XM antibody, P2rxl1 antibody, P2x6 antibody, P2xm antibody, Rnap2x6 antibody, purinergic receptor P2X 6 antibody, purinergic receptor P2X, ligand-gated ion channel, 6 antibody, P2X purinoceptor 6 antibody, P2RX6 antibody, P2rx6 antibody, LOC100051842 antibody, LOC100588488 antibody

Background: P2RXL1 encodes a protein in the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. P2RXL1 is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells.

Molecular Weight: 47 kDa (MW of target protein)