KCNH3 antibody
-
- Target See all KCNH3 (Kcnh3) Antibodies
- KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNH3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET
- Top Product
- Discover our top product Kcnh3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNH3 Blocking Peptide, catalog no. 33R-5570, is also available for use as a blocking control in assays to test for specificity of this KCNH3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))
- Alternative Name
- KCNH3 (Kcnh3 Products)
- Synonyms
- BEC1 antibody, ELK2 antibody, Kv12.2 antibody, AU019351 antibody, C030044P22Rik antibody, Elk2 antibody, Melk2 antibody, Bec1 antibody, potassium voltage-gated channel subfamily H member 3 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 3 antibody, KCNH3 antibody, Kcnh3 antibody
- Background
- This gene encodes a pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly
- Molecular Weight
- 117 kDa (MW of target protein)
-