KCNG4 antibody (N-Term)

Catalog No. ABIN633751

Product Details anti-KCNG4 Antibody

Target: KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNG4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNG4 antibody was raised against the N terminal of KCNG4

Purification: Affinity purified

Immunogen: KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNG4 Blocking Peptide, catalog no. 33R-7518, is also available for use as a blocking control in assays to test for specificity of this KCNG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNG4

Target: KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))

Alternative Name: KCNG4 (Kcng4 Products)

Synonyms: si:dkey-246g23.3 antibody, KV6.3 antibody, KV6.4 antibody, 4921535I01Rik antibody, AW049024 antibody, potassium voltage-gated channel, subfamily G, member 4a antibody, potassium voltage-gated channel modifier subfamily G member 4 antibody, potassium voltage-gated channel, subfamily G, member 4 antibody, kcng4a antibody, KCNG4 antibody, Kcng4 antibody

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.

Molecular Weight: 59 kDa (MW of target protein)