TRPC3 antibody (N-Term)

Catalog No. ABIN633752

Product Details anti-TRPC3 Antibody

Target: TRPC3 (Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRPC3 antibody was raised against the n terminal of TRPC3

Purification: Affinity purified

Immunogen: TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPC3 Blocking Peptide, catalog no. 33R-5923, is also available for use as a blocking control in assays to test for specificity of this TRPC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPC3

Target: TRPC3 (Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3))

Alternative Name: TRPC3 (TRPC3 Products)

Synonyms: TRPC3 antibody, Trpc3 antibody, TRP3 antibody, Mwk antibody, Trcp3 antibody, Trp3 antibody, Trrp3 antibody, TrpC3c antibody, transient receptor potential cation channel subfamily C member 3 antibody, transient receptor potential cation channel, subfamily C, member 3 antibody, TRPC3 antibody, Trpc3 antibody

Background: TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.

Molecular Weight: 97 kDa (MW of target protein)