ECHDC2 antibody (Middle Region)
-
- Target See all ECHDC2 products
- ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ECHDC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ECHDC2 antibody was raised against the middle region of ECHDC2
- Purification
- Affinity purified
- Immunogen
- ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ECHDC2 Blocking Peptide, catalog no. 33R-9249, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))
- Alternative Name
- ECHDC2 (ECHDC2 Products)
- Synonyms
- NV16396 antibody, id:ibd1032 antibody, wu:fc83b02 antibody, zgc:56321 antibody, zgc:85763 antibody, RGD1308525 antibody, 1300017C12Rik antibody, 2610009M20Rik antibody, D4Ertd765e antibody, enoyl-CoA hydratase domain containing 2 antibody, methylglutaconyl-CoA hydratase, mitochondrial antibody, enoyl CoA hydratase domain containing 2 antibody, enoyl Coenzyme A hydratase domain containing 2 antibody, ECHDC2 antibody, echdc2 antibody, LOC100121877 antibody, Echdc2 antibody
- Background
- ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.
- Molecular Weight
- 28 kDa (MW of target protein)
-