WNT5B antibody (Middle Region)

Catalog No. ABIN633862

Product Details anti-WNT5B Antibody

Target: WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT5B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT5 B antibody was raised against the middle region of WNT5

Purification: Affinity purified

Immunogen: WNT5 B antibody was raised using the middle region of WNT5 corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT5B Blocking Peptide, catalog no. 33R-10059, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT5B

Target: WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))

Alternative Name: WNT5B (WNT5B Products)

Synonyms: wnt-5b antibody, xwnt5b antibody, WNT5B antibody, AW545702 antibody, Wnt-5b antibody, xwnt-5c antibody, CHUNP6928 antibody, id:ibd5111 antibody, ppt antibody, wnt-5 antibody, wnt5 antibody, wnt[b] antibody, wu:fk85g06 antibody, Wnt family member 5B antibody, wingless-type MMTV integration site family, member 5B antibody, Wnt family member 5B S homeolog antibody, wingless-type MMTV integration site family, member 5b antibody, wnt5b antibody, WNT5B antibody, Wnt5b antibody, wnt5b.S antibody

Background: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: WNT Signaling, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation