Manic Fringe antibody (C-Term)

Catalog No. ABIN633865

This Rabbit Polyclonal antibody specifically detects Manic Fringe in WB. It exhibits reactivity toward Human.

Quick Overview for Manic Fringe antibody (C-Term) (ABIN633865)

Target: Manic Fringe (MFNG) (MFNG)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Manic Fringe antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Manic Fringe Antibody

Binding Specificity: C-Term

Specificity: MFNG antibody was raised against the C terminal of MFNG

Purification: Affinity purified

Immunogen: MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFNG Blocking Peptide, (ABIN5614739), is also available for use as a blocking control in assays to test for specificity of this MFNG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Manic Fringe

Target: Manic Fringe (MFNG) (MFNG)

Alternative Name: MFNG

Background: MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Notch Signaling