MMP13 antibody

Catalog No. ABIN633868

Product Details anti-MMP13 Antibody

Target: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP13 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MMP13 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP13 Blocking Peptide, catalog no. 33R-3728, is also available for use as a blocking control in assays to test for specificity of this MMP13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP13

Target: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Alternative Name: MMP13 (MMP13 Products)

Synonyms: CLG3 antibody, MANDP1 antibody, Clg antibody, MMP-13 antibody, Mmp1 antibody, cb1034 antibody, mmp13 antibody, gene A antibody, xCol antibody, xcl3 antibody, MMP13 antibody, MGC108008 antibody, matrix metallopeptidase 13 antibody, matrix metallopeptidase 13a antibody, matrix metallopeptidase 13 (collagenase 3) like S homeolog antibody, matrix metallopeptidase 13 (collagenase 3) antibody, matrix metalloproteinase 13 antibody, matrix metallopeptidase 13 (collagenase 3) like L homeolog antibody, MMP13 antibody, Mmp13 antibody, mmp13a antibody, mmp13l.S antibody, mmp13 antibody, LOC100136348 antibody, mmp13l.L antibody

Background: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes.

Molecular Weight: 42 kDa (MW of target protein)