GPX3 antibody

Catalog No. ABIN633878

Product Details anti-GPX3 Antibody

Target: GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPX3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPX3 Blocking Peptide, catalog no. 33R-1870, is also available for use as a blocking control in assays to test for specificity of this GPX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPX3

Target: GPX3 (Glutathione Peroxidase 3 (Plasma) (GPX3))

Alternative Name: GPX3 (GPX3 Products)

Synonyms: GPX3 antibody, DKFZp469D1932 antibody, AA960521 antibody, EGPx antibody, GPx antibody, GSHPx-3 antibody, GSHPx-P antibody, GPx-3 antibody, GPx-P antibody, Gpxp antibody, glutathione peroxidase 3 antibody, gpx3 antibody, GPX3 antibody, Gpx3 antibody

Background: GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis