beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2) (Middle Region) antibody

Details for Product No. ABIN633900
Antigen
  • B3GalNAc-T2
  • MDDGA11
  • RGD1306946
  • zgc:112351
  • A930105D20Rik
  • C80633
  • D230016N13Rik
  • beta-1,3-N-acetylgalactosaminyltransferase 2
  • beta-1,3-N-acetylgalactosaminyltransferase 2 L homeolog
  • UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2
  • B3GALNT2
  • b3galnt2
  • B3galnt2
  • b3galnt2.L
Epitope
Middle Region
3
1
1
Reactivity
Human, Mouse (Murine)
21
10
8
3
3
3
3
3
2
1
1
Host
Rabbit
19
2
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
Western Blotting (WB)
14
7
3
Options
Immunogen B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids GKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMG
Specificity B3 GALNT2 antibody was raised against the middle region of B3 ALNT2
Purification Affinity purified
Antigen
Alternative Name B3GALNT2 (B3GALNT2 Antibody Abstract)
Background B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
Molecular Weight 57 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

B3GALNT2 Blocking Peptide, catalog no. 33R-3380, is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Western Blotting (WB) image for anti-beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2) (Middle Region) antibody (ABIN633900) B3GALNT2 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?