FBLN3 antibody (Middle Region)
-
- Target See all FBLN3 Antibodies
- FBLN3 (Fibulin 3 (FBLN3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBLN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EFEMP1 antibody was raised against the middle region of EFEMP1
- Purification
- Affinity purified
- Immunogen
- EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
- Top Product
- Discover our top product FBLN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EFEMP1 Blocking Peptide, catalog no. 33R-4746, is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBLN3 (Fibulin 3 (FBLN3))
- Alternative Name
- EFEMP1 (FBLN3 Products)
- Synonyms
- DHRD antibody, DRAD antibody, FBLN3 antibody, FBNL antibody, FIBL-3 antibody, MLVT antibody, MTLV antibody, S1-5 antibody, T16 antibody, EGF containing fibulin like extracellular matrix protein 1 antibody, EGF-containing fibulin-like extracellular matrix protein 1 antibody, epidermal growth factor-containing fibulin-like extracellular matrix protein 1 antibody, EFEMP1 antibody, Efemp1 antibody
- Background
- EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-