PLA2G5 antibody (Middle Region)
-
- Target See all PLA2G5 Antibodies
- PLA2G5 (phospholipase A2, Group V (PLA2G5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLA2G5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLA2 G5 antibody was raised against the middle region of PLA2 5
- Purification
- Affinity purified
- Immunogen
- PLA2 G5 antibody was raised using the middle region of PLA2 5 corresponding to a region with amino acids YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
- Top Product
- Discover our top product PLA2G5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLA2G5 Blocking Peptide, catalog no. 33R-10222, is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLA2G5 (phospholipase A2, Group V (PLA2G5))
- Alternative Name
- PLA2G5 (PLA2G5 Products)
- Synonyms
- PLA2 antibody, sPLA2 antibody, FRFB antibody, GV-PLA2 antibody, PLA2-10 antibody, hVPLA(2) antibody, phospholipase A2 group V antibody, phospholipase A2, group V antibody, PLA2G5 antibody, Pla2g5 antibody
- Background
- This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.
- Molecular Weight
- 14 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-