CHST6 antibody
-
- Target See all CHST6 Antibodies
- CHST6 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 6 (CHST6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHST6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
- Top Product
- Discover our top product CHST6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHST6 Blocking Peptide, catalog no. 33R-7529, is also available for use as a blocking control in assays to test for specificity of this CHST6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST6 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 6 (CHST6))
- Alternative Name
- CHST6 (CHST6 Products)
- Synonyms
- mcdc1 antibody, MCDC1 antibody, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 L homeolog antibody, carbohydrate sulfotransferase 6 antibody, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 antibody, chst6.L antibody, LOC711570 antibody, CHST6 antibody, LOC100477677 antibody, LOC489707 antibody
- Background
- CHST6 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. It mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. CHST6 acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N-acetyllactosamine structures.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-