WNT2 antibody (Middle Region)

Catalog No. ABIN633953

Product Details anti-WNT2 Antibody

Target: WNT2 (Wingless-Type MMTV Integration Site Family Member 2 (WNT2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT2 antibody was raised against the middle region of WNT2

Purification: Affinity purified

Immunogen: WNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT2 Blocking Peptide, catalog no. 33R-3548, is also available for use as a blocking control in assays to test for specificity of this WNT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT2

Target: WNT2 (Wingless-Type MMTV Integration Site Family Member 2 (WNT2))

Alternative Name: WNT2 (WNT2 Products)

Synonyms: CG1916 antibody, D-wnt-2 antibody, DWnt-2 antibody, DWnt2 antibody, Dm DWnt2 antibody, Dm-2 antibody, Dmel\\CG1916 antibody, Dwnt-2 antibody, Wnt antibody, Wnt-2 antibody, dWnt2 antibody, wnt2 antibody, WNT2 antibody, irp antibody, Xwnt2 antibody, wnt-2 antibody, Xwnt-2 antibody, int1l1 antibody, 2610510E18Rik antibody, Int1l1 antibody, Irp antibody, Mirp antibody, Wnt2a antibody, INT1L1 antibody, IRP antibody, ZfWnt2 antibody, Wnt oncogene analog 2 antibody, Wnt family member 2 antibody, wingless-type MMTV integration site family member 2 antibody, wingless-type MMTV integration site family, member 2 antibody, Wnt2 antibody, wnt2 antibody, WNT2 antibody

Background: WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: WNT Signaling