PDIA6 antibody (Middle Region)
-
- Target See all PDIA6 Antibodies
- PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDIA6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDIA6 antibody was raised against the middle region of PDIA6
- Purification
- Affinity purified
- Immunogen
- PDIA6 antibody was raised using the middle region of PDIA6 corresponding to a region with amino acids KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA
- Top Product
- Discover our top product PDIA6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDIA6 Blocking Peptide, catalog no. 33R-4499, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))
- Alternative Name
- PDIA6 (PDIA6 Products)
- Background
- Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling, Cell RedoxHomeostasis
-