EPX antibody (Middle Region)

Catalog No. ABIN634017

Product Details anti-EPX Antibody

Target: EPX (Eosinophil Peroxidase (EPX))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPX antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EPX antibody was raised against the middle region of EPX

Purification: Affinity purified

Immunogen: EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPX Blocking Peptide, catalog no. 33R-4765, is also available for use as a blocking control in assays to test for specificity of this EPX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPX

Target: EPX (Eosinophil Peroxidase (EPX))

Alternative Name: EPX (EPX Products)

Synonyms: EPX antibody, pmr-1 antibody, EPO antibody, EPP antibody, EPX-PEN antibody, eosinophil peroxidase antibody, eosinophil peroxidase L homeolog antibody, LOC788751 antibody, EPX antibody, epx.L antibody, Epx antibody

Background: EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).

Molecular Weight: 53 kDa (MW of target protein)