LYZL6 antibody (N-Term)

Catalog No. ABIN634036

Product Details anti-LYZL6 Antibody

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYZL6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYZL6 antibody was raised against the N terminal of LYZL6

Purification: Affinity purified

Immunogen: LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYZL6 Blocking Peptide, catalog no. 33R-6547, is also available for use as a blocking control in assays to test for specificity of this LYZL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYZL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYZL6

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Alternative Name: LYZL6 (LYZL6 Products)

Synonyms: LYC1 antibody, PRO1485 antibody, TKAL754 antibody, UNQ754 antibody, 1700023H08Rik antibody, Lyc1 antibody, RGD1306968 antibody, lysozyme like 6 antibody, lysozyme-like protein 6 antibody, lysozyme-like 6 antibody, LYZL6 antibody, LOC480492 antibody, Lyzl6 antibody

Background: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Molecular Weight: 16 kDa (MW of target protein)