PLA1A antibody (Middle Region)

Catalog No. ABIN634039

Product Details anti-PLA1A Antibody

Target: PLA1A (Phospholipase A1 Member A (PLA1A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLA1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLA1 A antibody was raised against the middle region of PLA1

Purification: Affinity purified

Immunogen: PLA1 A antibody was raised using the middle region of PLA1 corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLA1A Blocking Peptide, catalog no. 33R-9022, is also available for use as a blocking control in assays to test for specificity of this PLA1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLA1A

Target: PLA1A (Phospholipase A1 Member A (PLA1A))

Alternative Name: PLA1A (PLA1A Products)

Synonyms: PS-PLA1 antibody, PSPLA1 antibody, AA986889 antibody, Ps-pla1 antibody, Pspla1 antibody, wu:fi26h09 antibody, zgc:77160 antibody, AH antibody, ARWH2 antibody, LAH2 antibody, LPDLR antibody, PLA1B antibody, mPA-PLA1 antibody, phospholipase A1 member A antibody, lipase H antibody, PLA1A antibody, Pla1a antibody, pla1a antibody, CpipJ_CPIJ002492 antibody, CpipJ_CPIJ007883 antibody, LIPH antibody

Background: Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.

Molecular Weight: 50 kDa (MW of target protein)