VPS29 antibody

Catalog No. ABIN634054

Product Details anti-VPS29 Antibody

Target: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS29 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS29 Blocking Peptide, catalog no. 33R-4834, is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS29

Target: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Alternative Name: VPS29 (VPS29 Products)

Synonyms: DC15 antibody, PEP11 antibody, 2010015D08Rik antibody, AW049835 antibody, VPS29 antibody, fb06g05 antibody, wu:fb06g05 antibody, zgc:56191 antibody, zgc:86638 antibody, VPT6 antibody, DDBDRAFT_0188107 antibody, DDBDRAFT_0234192 antibody, DDB_0188107 antibody, DDB_0234192 antibody, vps29 antibody, 17.m07782 antibody, ATVPS29 antibody, MAIGO 1 antibody, VACUOLAR PROTEIN SORTING 29 antibody, VPS29, retromer complex component antibody, VPS29 retromer complex component antibody, vacuolar protein sorting 29 homolog (S. cerevisiae) antibody, retromer subunit VPS29 antibody, retromer subunit antibody, protein involved in endosome to golgi protein transport antibody, subunit of retromer complex antibody, metallophosphoesterase domain-containing protein antibody, VPS29 retromer complex component S homeolog antibody, vacuolar protein sorting-associated protein 29 antibody, vacuolar protein sorting 29 antibody, Calcineurin-like metallo-phosphoesterase superfamily protein antibody, vacuolar protein sorting 29 homolog antibody, retromer complex subunit Vps29 antibody, VPS29 antibody, Vps29 antibody, vps29 antibody, CAALFM_C100320WA antibody, vps29.S antibody, ANI_1_150074 antibody, AOR_1_1618194 antibody, CpipJ_CPIJ011219 antibody, MCYG_08523 antibody, PITG_21643 antibody, MGYG_08674 antibody, LOC733048 antibody, cgd7_2060 antibody, PVX_086095 antibody, BBOV_III008970 antibody, CMU_034100 antibody, LOC100281359 antibody, MAG1 antibody, TERG_02857 antibody, Tsp_08912a antibody, Tsp_08912 antibody, Tsp_08917 antibody

Background: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.

Molecular Weight: 20 kDa (MW of target protein)