HECA antibody

Catalog No. ABIN634109

Product Details anti-HECA Antibody

Target: HECA (Headcase Homolog (HECA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HECA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HECA Blocking Peptide, catalog no. 33R-3766, is also available for use as a blocking control in assays to test for specificity of this HECA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HECA

Target: HECA (Headcase Homolog (HECA))

Alternative Name: HECA (HECA Products)

Synonyms: HECA antibody, si:dkey-34f16.2 antibody, HDC antibody, HDCL antibody, HHDC antibody, dJ225E12.1 antibody, Gm869 antibody, hdc homolog, cell cycle regulator antibody, Heca antibody, HECA antibody, heca antibody

Background: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.

Molecular Weight: 59 kDa (MW of target protein)