KIF3B antibody (C-Term)

Catalog No. ABIN634133

Product Details anti-KIF3B Antibody

Target: KIF3B (Kinesin Family Member 3B (KIF3B))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF3B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF3 B antibody was raised against the C terminal of KIF3

Purification: Affinity purified

Immunogen: KIF3 B antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF3B Blocking Peptide, catalog no. 33R-1426, is also available for use as a blocking control in assays to test for specificity of this KIF3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF3B

Target: KIF3B (Kinesin Family Member 3B (KIF3B))

Alternative Name: KIF3B (KIF3B Products)

Synonyms: FLA8 antibody, HH0048 antibody, KLP-11 antibody, AI854312 antibody, AW549267 antibody, mKIAA0359 antibody, kinesin family member 3B antibody, KIF3B antibody, Kif3b antibody

Background: The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Hedgehog Signaling, M Phase