BTG4 antibody (Middle Region)

Catalog No. ABIN634168

Product Details anti-BTG4 Antibody

Target: BTG4 (B-Cell Translocation Gene 4 (BTG4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTG4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTG4 antibody was raised against the middle region of BTG4

Purification: Affinity purified

Immunogen: BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTG4

Target: BTG4 (B-Cell Translocation Gene 4 (BTG4))

Alternative Name: BTG4 (BTG4 Products)

Synonyms: SCIR-27 antibody, b9-a antibody, pc3b antibody, C86116 antibody, PC3B antibody, BTG anti-proliferation factor 4 antibody, BTG family member 4 L homeolog antibody, B cell translocation gene 4 antibody, Btg4 antibody, btg4.L antibody, BTG4 antibody

Background: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Molecular Weight: 26 kDa (MW of target protein)