RRM2 antibody (N-Term)

Catalog No. ABIN634182

Product Details anti-RRM2 Antibody

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RRM2 antibody was raised against the N terminal of RRM2

Purification: Affinity purified

Immunogen: RRM2 antibody was raised using the N terminal of RRM2 corresponding to a region with amino acids PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRM2 Blocking Peptide, catalog no. 33R-6966, is also available for use as a blocking control in assays to test for specificity of this RRM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRM2

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Alternative Name: RRM2 (RRM2 Products)

Synonyms: R2 antibody, RR2 antibody, RR2M antibody, AA407299 antibody, rrm2 antibody, rr2m antibody, cb111 antibody, chunp6884 antibody, r2 antibody, ribonucleotide reductase regulatory subunit M2 antibody, ribonucleotide reductase M2 antibody, ribonucleotide reductase M2, gene 2 L homeolog antibody, ribonucleotide reductase M2, gene 1 antibody, ribonucleotide reductase M2 polypeptide antibody, RRM2 antibody, Rrm2 antibody, rrm2.2.L antibody, rrm2.1 antibody, rrm2 antibody

Background: RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases