CCNYL1 antibody (N-Term)

Catalog No. ABIN634208

Product Details anti-CCNYL1 Antibody

Target: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCNYL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin Y-Like 1 antibody was raised against the N terminal of CCNYL1

Purification: Affinity purified

Immunogen: Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin Y-Like 1 Blocking Peptide, catalog no. 33R-9359, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y-Like 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNYL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCNYL1

Target: CCNYL1 (Cyclin Y-Like 1 (CCNYL1))

Alternative Name: Cyclin Y-Like 1 (CCNYL1 Products)

Synonyms: 9630037P07Rik antibody, AW554339 antibody, RGD1310683 antibody, ccnyl1 antibody, MGC153047 antibody, wu:fi41h04 antibody, CH1073-226M24.2 antibody, cyclin Y like 1 antibody, cyclin Y-like 1 antibody, microRNA 4775 antibody, cyclin Y like 1 L homeolog antibody, cyclin Y like 1 S homeolog antibody, CCNYL1 antibody, Ccnyl1 antibody, MIR4775 antibody, ccnyl1.L antibody, ccnyl1.S antibody, ccnyl1 antibody

Background: The specific function of CCNYL1 is not yet known.

Molecular Weight: 33 kDa (MW of target protein)