IL-1 beta antibody (N-Term)

Catalog No. ABIN634267

This Rabbit Polyclonal antibody specifically detects IL-1 beta in WB. It exhibits reactivity toward Human.

Quick Overview for IL-1 beta antibody (N-Term) (ABIN634267)

Target: IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-1 beta antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL-1 beta Antibody

Binding Specificity: N-Term

Specificity: IL1 beta antibody was raised against the N terminal of IL1 B

Purification: Affinity purified

Immunogen: IL1 beta antibody was raised using the N terminal of IL1 B corresponding to a region with amino acids MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL1 beta Blocking Peptide, (ABIN5614166), is also available for use as a blocking control in assays to test for specificity of this IL1 beta antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-1 beta

Target: IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))

Alternative Name: IL1 beta

Background: IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Interferon-gamma Pathway, TLR Signaling, Negative Regulation of Hormone Secretion, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Autophagy, Cancer Immune Checkpoints, Inflammasome