JAK3 antibody

Catalog No. ABIN634320

The Rabbit Polyclonal anti-JAK3 antibody (ABIN634320) specifically detects JAK3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for JAK3 antibody (ABIN634320)

Target: JAK3 (Janus Kinase 3 (JAK3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JAK3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-JAK3 Antibody

Purification: Affinity purified

Immunogen: JAK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JAK3 Blocking Peptide, (ABIN939905), is also available for use as a blocking control in assays to test for specificity of this JAK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JAK3

Target: JAK3 (Janus Kinase 3 (JAK3))

Alternative Name: JAK3

Background: JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).

Molecular Weight: 125 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, RTK Signaling, Response to Growth Hormone Stimulus, Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus, Activated T Cell Proliferation, Unfolded Protein Response