+1 877 302 8632
+1 888 205 9894 (Toll-free)

Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (Middle Region) antibody Primary Antibody

NCF4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634326
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Neutrophil Cytosolic Factor 4, 40kDa (NCF4)
    Binding Specificity
    • 18
    • 15
    • 8
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    • 86
    • 30
    • 15
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 74
    • 7
    • 6
    • 84
    • 3
    • 39
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 41
    • 26
    • 26
    • 26
    • 19
    • 12
    • 6
    • 5
    • 2
    • 2
    • 1
    Western Blotting (WB)
    NCF4 antibody was raised against the middle region of NCF4
    Affinity purified
    NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    NCF4 Blocking Peptide, catalog no. 33R-9086, is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody

    For Research Use only
  • Format
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCF4 antibody in PBS
    Lot specific
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Neutrophil Cytosolic Factor 4, 40kDa (NCF4)
    Alternative Name
    NCF4 (NCF4 Antibody Abstract)
    p40phox, AI451400, NCF, P40PHOX, SH3PXD4, neutrophil cytosolic factor 4, ncf4, Ncf4, NCF4
    NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.
    Molecular Weight
    39 kDa (MW of target protein)
You are here:
help Support