Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 1-339) antibody Primary Antibody

NCF4 Reactivity: Human IF, WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN518211
$510.67
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Neutrophil Cytosolic Factor 4, 40kDa (NCF4)
    Binding Specificity
    AA 1-339
    • 17
    • 8
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 65
    • 42
    • 26
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    Host
    Rabbit
    • 55
    • 7
    • 6
    Clonality
    Polyclonal
    • 65
    • 3
    Conjugate
    Un-conjugated
    • 39
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), Western Blotting (WB)
    • 43
    • 20
    • 19
    • 13
    • 8
    • 4
    • 3
    • 2
    • 1
    Purpose
    Rabbit polyclonal antibody raised against a full-length human NCF4 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: NCF4 (NP_000622.2, 1 a.a. ~ 339 a.a) full-length human protein.

    Immunogen Sequence: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Neutrophil Cytosolic Factor 4, 40kDa (NCF4)
    Alternative Name
    NCF4 (NCF4 Antibody Abstract)
    Synonyms
    p40phox, AI451400, NCF, P40PHOX, SH3PXD4, neutrophil cytosolic factor 4, ncf4, Ncf4, NCF4
    Background
    Full Gene Name: neutrophil cytosolic factor 4, 40 kDa
    Synonyms: MGC3810,NCF,P40PHOX,SH3PXD4
    Gene ID
    4689
    NCBI Accession
    NP_000622, NM_000631
You are here:
help Support