Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 1-339) antibody Primary Antibody
NCF4
Reactivity: Human
WB
Host: Mouse
Polyclonal
unconjugated
camera_alt 2
Catalog No. ABIN518210
$364.00
Plus shipping costs $45.00
50 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-339
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human NCF4 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: NCF4 (NP_000622.2, 1 a.a. ~ 339 a.a) full-length human protein.
Immunogen Sequence: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- NCF4 (NCF4 Antibody Abstract)
- Synonyms
- p40phox, AI451400, NCF, P40PHOX, SH3PXD4, neutrophil cytosolic factor 4, ncf4, Ncf4, NCF4
- Background
- Full Gene Name: neutrophil cytosolic factor 4, 40 kDa
Synonyms: MGC3810,NCF,P40PHOX,SH3PXD4 - Gene ID
- 4689
- NCBI Accession
- NP_000622, NM_000631
You are here: