Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 1-339) antibody Primary Antibody
-
- Target
- Binding Specificity
- AA 1-339
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a full-length human NCF4 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: NCF4 (NP_000622.2, 1 a.a. ~ 339 a.a) full-length human protein.
Immunogen Sequence: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
-
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 111-339) antibody Primary Antibody
NCF4 Reactivity: Mouse ICC, IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (Internal Region) antibody Primary AntibodyNCF4 Reactivity: Human IHC, ELISA, WB Host: Goat Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (pTyr243) antibody Primary AntibodyNCF4 Reactivity: Human, Mouse ELISA, IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 260-289), (C-Term) antibody Primary AntibodyNCF4 Reactivity: Human FACS, IHC (p), WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) antibody Primary AntibodyNCF4 Reactivity: Human, Mouse, Rat IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 132-339) antibody Primary AntibodyNCF4 Reactivity: Human ICC, IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 115-170) antibody Primary AntibodyNCF4 Reactivity: Human, Mouse, Rat IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (AA 1-339) antibody Primary AntibodyNCF4 Reactivity: Human IF, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (Center) antibody Primary AntibodyNCF4 Reactivity: Human, Pig, Rabbit IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (N-Term) antibody Primary AntibodyNCF4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- NCF4 (NCF4 Antibody Abstract)
- Synonyms
- p40phox, AI451400, NCF, P40PHOX, SH3PXD4, neutrophil cytosolic factor 4, ncf4, Ncf4, NCF4
- Background
- Full Gene Name: neutrophil cytosolic factor 4, 40 kDa
Synonyms: MGC3810,NCF,P40PHOX,SH3PXD4 - Gene ID
- 4689
- NCBI Accession
- NP_000622, NM_000631