STK38 antibody (C-Term)

Catalog No. ABIN634342

Product Details anti-STK38 Antibody

Target: STK38 (serine/threonine Kinase 38 (STK38))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STK38 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STK38 antibody was raised against the C terminal of STK38

Purification: Affinity purified

Immunogen: STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK38 Blocking Peptide, catalog no. 33R-3966, is also available for use as a blocking control in assays to test for specificity of this STK38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STK38

Target: STK38 (serine/threonine Kinase 38 (STK38))

Alternative Name: STK38 (STK38 Products)

Synonyms: NDR antibody, NDR1 antibody, 5830476G13Rik antibody, 9530097A09Rik antibody, AA617404 antibody, Ndr1 antibody, trc antibody, si:ch1073-272h17.2 antibody, wu:fj80h03 antibody, zgc:55572 antibody, serine/threonine kinase 38 antibody, serine/threonine kinase 38 S homeolog antibody, serine/threonine kinase 38b antibody, serine/threonine kinase 38a antibody, STK38 antibody, Stk38 antibody, stk38.S antibody, stk38b antibody, stk38a antibody

Background: STK38 belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family. It contains 1 AGC-kinase C-terminal domain and 1 protein kinase domain. NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.

Molecular Weight: 54 kDa (MW of target protein)