PTK6 antibody (Middle Region)

Catalog No. ABIN634359

Product Details anti-PTK6 Antibody

Target: PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTK6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTK6 antibody was raised against the middle region of PTK6

Purification: Affinity purified

Immunogen: PTK6 antibody was raised using the middle region of PTK6 corresponding to a region with amino acids SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTK6 Blocking Peptide, catalog no. 33R-8390, is also available for use as a blocking control in assays to test for specificity of this PTK6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTK6

Target: PTK6 (PTK6 Protein tyrosine Kinase 6 (PTK6))

Alternative Name: PTK6 (PTK6 Products)

Synonyms: BRK antibody, Sik antibody, Tksk antibody, tks antibody, zgc:153964 antibody, protein tyrosine kinase 6 antibody, PTK6 protein tyrosine kinase 6 antibody, PTK6 protein tyrosine kinase 6b antibody, PTK6 antibody, Ptk6 antibody, ptk6b antibody

Background: The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues.

Molecular Weight: 52 kDa (MW of target protein)