CD160 antibody (Middle Region)

Catalog No. ABIN634374

Product Details anti-CD160 Antibody

Target: CD160

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD160 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CD160 antibody was raised against the middle region of CD160

Purification: Affinity purified

Immunogen: CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CD160 Blocking Peptide, catalog no. 33R-8498, is also available for use as a blocking control in assays to test for specificity of this CD160 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CD160

Target: CD160

Alternative Name: CD160 (CD160 Products)

Synonyms: CD160 antibody, RGD1563598 antibody, BY55 antibody, AU045688 antibody, By55 antibody, NK1 antibody, NK28 antibody, CD160 molecule antibody, CD160 antigen antibody, CD160 antibody, Cd160 antibody

Background: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity.

Molecular Weight: 20 kDa (MW of target protein)