RASL12 antibody (N-Term)

Catalog No. ABIN634395

Product Details anti-RASL12 Antibody

Target: RASL12 (RAS-Like, Family 12 (RASL12))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASL12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RASL12 antibody was raised against the N terminal of RASL12

Purification: Affinity purified

Immunogen: RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASL12 Blocking Peptide, catalog no. 33R-6517, is also available for use as a blocking control in assays to test for specificity of this RASL12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASL12

Target: RASL12 (RAS-Like, Family 12 (RASL12))

Alternative Name: RASL12 (RASL12 Products)

Synonyms: RIS antibody, 4631404I11Rik antibody, zgc:63633 antibody, RAS like family 12 antibody, RAS-like, family 12 antibody, RASL12 antibody, Rasl12 antibody, rasl12 antibody

Background: The function of RASL12 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)