PKC gamma antibody (N-Term)

Catalog No. ABIN634423

Product Details anti-PKC gamma Antibody

Target: PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PKC gamma antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKCG antibody was raised against the N terminal of PRKCG

Purification: Affinity purified

Immunogen: PRKCG antibody was raised using the N terminal of PRKCG corresponding to a region with amino acids FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKCG Blocking Peptide, catalog no. 33R-3124, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PKC gamma

Target: PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))

Alternative Name: PRKCG (PRKCG Products)

Synonyms: PRKCG antibody, PKC-gamma antibody, PKCC antibody, PKCG antibody, SCA14 antibody, PKCgamma antibody, Pkcc antibody, Prkcc antibody, PKC antibody, PKCI antibody, Prkc antibody, RATPKCI antibody, protein kinase C gamma antibody, protein kinase C, gamma antibody, protein kinase C gamma type antibody, PRKCG antibody, Prkcg antibody, LOC484316 antibody

Background: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Molecular Weight: 78 kDa (MW of target protein)

Pathways: WNT Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling