TBL3 antibody
-
- Target See all TBL3 Antibodies
- TBL3 (Transducin (Beta)-Like 3 (TBL3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TBL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL
- Top Product
- Discover our top product TBL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TBL3 Blocking Peptide, catalog no. 33R-5646, is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBL3 (Transducin (Beta)-Like 3 (TBL3))
- Alternative Name
- TBL3 (TBL3 Products)
- Synonyms
- MGC69179 antibody, zgc:101778 antibody, AmCG7589 antibody, GB11903 antibody, SAZD antibody, UTP13 antibody, 9430070M15Rik antibody, transducin (beta)-like 3 L homeolog antibody, transducin beta like 3 antibody, transducin (beta)-like 3 antibody, transducin beta-like protein 3 antibody, tbl3.L antibody, TBL3 antibody, tbl3 antibody, LOC724596 antibody, Tbl3 antibody
- Background
- The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.
- Molecular Weight
- 89 kDa (MW of target protein)
-