Fetuin A antibody (N-Term)

Catalog No. ABIN634489

Product Details anti-Fetuin A Antibody

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fetuin A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AHSG antibody was raised against the N terminal of AHSG

Purification: Affinity purified

Immunogen: AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AHSG Blocking Peptide, catalog no. 33R-1451, is also available for use as a blocking control in assays to test for specificity of this AHSG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHSG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fetuin A

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Alternative Name: AHSG (AHSG Products)

Synonyms: ahs antibody, a2hs antibody, hsga antibody, fetua antibody, wu:fb63g02 antibody, zgc:103687 antibody, AHSG antibody, MGC116429 antibody, A2HS antibody, AHS antibody, FETUA antibody, HSGA antibody, Aa2-066 antibody, pp63 antibody, alpha-2-HS-glycoprotein antibody, alpha 2-HS glycoprotein antibody, alpha-2-HS-glycoprotein 1 antibody, alpha-2-HS-glycoprotein L homeolog antibody, Cphamn1_1981 antibody, AHSG antibody, ahsg antibody, ahsg1 antibody, ahsg.L antibody, Ahsg antibody

Background: Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. However, its exact significance is still obscure.

Molecular Weight: 39 kDa (MW of target protein)