STK3 antibody

Catalog No. ABIN634509

Product Details anti-STK3 Antibody

Target: STK3 (serine/threonine Kinase 3 (STK3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STK3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK3 Blocking Peptide, catalog no. 33R-5949, is also available for use as a blocking control in assays to test for specificity of this STK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STK3

Target: STK3 (serine/threonine Kinase 3 (STK3))

Alternative Name: STK3 (STK3 Products)

Synonyms: KRS1 antibody, MST2 antibody, 0610042I06Rik antibody, MST antibody, Mst2 antibody, Mst3 antibody, Ste20 antibody, mess1 antibody, mst2 antibody, xstk3 antibody, wu:fc19e11 antibody, zgc:55383 antibody, serine/threonine kinase 3 antibody, serine/threonine kinase 3 S homeolog antibody, serine/threonine kinase 3 (STE20 homolog, yeast) antibody, STK3 antibody, Stk3 antibody, stk3.S antibody, stk3 antibody

Background: Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Tube Formation