RHOT1 antibody (N-Term)

Catalog No. ABIN634526

Product Details anti-RHOT1 Antibody

Target: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RHOT1 antibody was raised against the N terminal of RHOT1

Purification: Affinity purified

Immunogen: RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOT1 Blocking Peptide, catalog no. 33R-6147, is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOT1

Target: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Alternative Name: RHOT1 (RHOT1 Products)

Synonyms: rhot1 antibody, zgc:55581 antibody, zgc:77063 antibody, wu:fd14e11 antibody, wu:fi14a05 antibody, arht2 antibody, miro-2 antibody, rasl antibody, ARHT1 antibody, MIRO-1 antibody, MIRO1 antibody, 2210403N23Rik antibody, AA415293 antibody, AF244542 antibody, AI834919 antibody, Arht1 antibody, C430039G08Rik antibody, Miro1 antibody, miro1 antibody, si:dkeyp-97g3.6 antibody, ras homolog family member T1a antibody, ras homolog family member T2 antibody, ras homolog family member T1 antibody, ras homolog family member T1 L homeolog antibody, rhot1a antibody, rhot2 antibody, RHOT1 antibody, rhot1 antibody, rhot1.L antibody, Rhot1 antibody, rhot1b antibody

Background: Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Molecular Weight: 71 kDa (MW of target protein)