ADCY8 antibody

Catalog No. ABIN634530

Product Details anti-ADCY8 Antibody

Target: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADCY8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADCY8 Blocking Peptide, catalog no. 33R-2494, is also available for use as a blocking control in assays to test for specificity of this ADCY8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADCY8

Target: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Alternative Name: ADCY8 (ADCY8 Products)

Synonyms: MGC121231 antibody, si:ch211-220f13.4 antibody, AC8 antibody, AW060868 antibody, ADCY3 antibody, HBAC1 antibody, Ac8 antibody, adenylate cyclase 8 (brain) S homeolog antibody, adenylate cyclase 8 antibody, adenylate cyclase 8 (brain) antibody, adenylate cyclase type 8 antibody, adenylate cyclase 3 antibody, adcy8.S antibody, ADCY8 antibody, adcy8 antibody, LOC100461383 antibody, Adcy8 antibody, ADCY3 antibody

Background: Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.

Molecular Weight: 140 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma