AIF antibody (C-Term)

Catalog No. ABIN634586

The Rabbit Polyclonal anti-AIF antibody is suitable to detect AIF in samples from Human, Rat, Mouse and Dog. It has been validated for WB.

Quick Overview for AIF antibody (C-Term) (ABIN634586)

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AIF Antibody

Binding Specificity: C-Term

Specificity: PDCD8 antibody was raised against the C terminal Of Pdcd8

Purification: Affinity purified

Immunogen: PDCD8 antibody was raised using the C terminal Of Pdcd8 corresponding to a region with amino acids VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDCD8 Blocking Peptide, (ABIN5615270), is also available for use as a blocking control in assays to test for specificity of this PDCD8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Alternative Name: PDCD8

Background: AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effect