PEA15 antibody (Middle Region)

Catalog No. ABIN634601

Product Details anti-PEA15 Antibody

Target: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEA15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PEA15 antibody was raised against the middle region of PEA15

Purification: Affinity purified

Immunogen: PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEA15 Blocking Peptide, catalog no. 33R-2058, is also available for use as a blocking control in assays to test for specificity of this PEA15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEA15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEA15

Target: PEA15 (phosphoprotein Enriched in Astrocytes 15 (PEA15))

Alternative Name: PEA15 (PEA15 Products)

Synonyms: HMAT1 antibody, HUMMAT1H antibody, MAT1 antibody, MAT1H antibody, PEA-15 antibody, PED antibody, Pea15a antibody, PEA15 antibody, DKFZp459O1410 antibody, proliferation and apoptosis adaptor protein 15 antibody, phosphoprotein enriched in astrocytes 15 antibody, proliferation and apoptosis adaptor protein 15 L homeolog antibody, Astrocytic phosphoprotein PEA-15 antibody, PEA15 antibody, Pea15 antibody, pea15.L antibody, pea15 antibody

Background: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Molecular Weight: 15 kDa (MW of target protein)