Claudin 16 antibody (C-Term)

Catalog No. ABIN634606

Product Details anti-Claudin 16 Antibody

Target: Claudin 16 (CLDN16)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 16 antibody was raised against the C terminal of CLDN16

Purification: Affinity purified

Immunogen: Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 16

Target: Claudin 16 (CLDN16)

Alternative Name: Claudin 16 (CLDN16 Products)

Synonyms: CLDN16 antibody, HOMG3 antibody, PCLN1 antibody, claudin-16 antibody, Pcln1 antibody, claudin 16 antibody, CLDN16 antibody, Cldn16 antibody

Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Hepatitis C