Annexin IV antibody (Middle Region)
-
- Target See all Annexin IV (ANXA4) Antibodies
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin IV antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Annexin A4 antibody was raised against the middle region of ANXA4
- Cross-Reactivity
- Human
- Purification
- Affinity purified
- Immunogen
- Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL
- Top Product
- Discover our top product ANXA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A4 Blocking Peptide, catalog no. 33R-2421, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
- Alternative Name
- Annexin A4 (ANXA4 Products)
- Synonyms
- ANXA4 antibody, Anx4 antibody, XAnx4 antibody, pig28 antibody, X-anx4 antibody, Xanx-4 antibody, ANXIV antibody, anx4 antibody, ANX4 antibody, PIG28 antibody, ZAP36 antibody, Annexin-4 antibody, P32.5 antibody, PAP-II antibody, PP4-X antibody, AI265406 antibody, AIV antibody, AW106930 antibody, annexin A4 antibody, annexin A4 L homeolog antibody, ANXA4 antibody, anxa4 antibody, CC1G_00713 antibody, LOC100280951 antibody, Anxa4 antibody, anxa4.L antibody
- Target Type
- Chemical
- Background
- Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.
- Molecular Weight
- 36 kDa (MW of target protein)
-