Annexin IV antibody (Middle Region)

Catalog No. ABIN634614

Product Details anti-Annexin IV Antibody

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Binding Specificity: Middle Region

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin IV antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A4 antibody was raised against the middle region of ANXA4

Cross-Reactivity: Human

Purification: Affinity purified

Immunogen: Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A4 Blocking Peptide, catalog no. 33R-2421, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin IV

Target: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Alternative Name: Annexin A4 (ANXA4 Products)

Synonyms: ANXA4 antibody, Anx4 antibody, XAnx4 antibody, pig28 antibody, X-anx4 antibody, Xanx-4 antibody, ANXIV antibody, anx4 antibody, ANX4 antibody, PIG28 antibody, ZAP36 antibody, Annexin-4 antibody, P32.5 antibody, PAP-II antibody, PP4-X antibody, AI265406 antibody, AIV antibody, AW106930 antibody, annexin A4 antibody, annexin A4 L homeolog antibody, ANXA4 antibody, anxa4 antibody, CC1G_00713 antibody, LOC100280951 antibody, Anxa4 antibody, anxa4.L antibody

Target Type: Chemical

Background: Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.

Molecular Weight: 36 kDa (MW of target protein)