ITGB3BP antibody

Catalog No. ABIN634666

This Rabbit Polyclonal antibody specifically detects ITGB3BP in WB. It exhibits reactivity toward Human.

Quick Overview for ITGB3BP antibody (ABIN634666)

Target: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITGB3BP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ITGB3BP Antibody

Purification: Affinity purified

Immunogen: ITGB3 BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITGB3BP Blocking Peptide, (ABIN5614227), is also available for use as a blocking control in assays to test for specificity of this ITGB3BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITGB3BP

Target: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Alternative Name: ITGB3BP

Background: ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway