ITGB3BP antibody
-
- Target See all ITGB3BP Antibodies
- ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ITGB3BP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ITGB3 BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE
- Top Product
- Discover our top product ITGB3BP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ITGB3BP Blocking Peptide, catalog no. 33R-9096, is also available for use as a blocking control in assays to test for specificity of this ITGB3BP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))
- Alternative Name
- ITGB3BP (ITGB3BP Products)
- Synonyms
- CENP-R antibody, CENPR antibody, HSU37139 antibody, NRIF3 antibody, TAP20 antibody, 4930471O16Rik antibody, AU022583 antibody, integrin subunit beta 3 binding protein antibody, integrin beta 3 binding protein (beta3-endonexin) antibody, ITGB3BP antibody, Itgb3bp antibody
- Background
- ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-