DSCAM antibody (Middle Region)
-
- Target See all DSCAM Antibodies
- DSCAM (Down Syndrome Cell Adhesion Molecule (DSCAM))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DSCAM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DSCAM antibody was raised against the middle region of DSCAM
- Purification
- Affinity purified
- Immunogen
- DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV
- Top Product
- Discover our top product DSCAM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DSCAM Blocking Peptide, catalog no. 33R-6387, is also available for use as a blocking control in assays to test for specificity of this DSCAM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSCAM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DSCAM (Down Syndrome Cell Adhesion Molecule (DSCAM))
- Alternative Name
- DSCAM (DSCAM Products)
- Synonyms
- CHD2-42 antibody, CHD2-52 antibody, Dscam antibody, DSCAM antibody, chd2-42 antibody, chd2-52 antibody, dscam antibody, GB15141 antibody, 4932410A21Rik antibody, 43Bc antibody, CG17800 antibody, CT39257 antibody, DScam antibody, DmDscam antibody, Dm_2R:13612 antibody, Dmel\\CG17800 antibody, Dscam-hv antibody, Dscam1 antibody, FBgn0033159 antibody, Neu1 antibody, dScam antibody, l(2)05518 antibody, l(2)43Bc antibody, p270 antibody, DS cell adhesion molecule antibody, Down syndrome cell adhesion molecule antibody, Down syndrome cell adhesion molecule a antibody, Down syndrome cell adhesion molecule 1 antibody, Down syndrome cell adhesion molecule-like protein Dscam2 antibody, down syndrome cell adhesion molecule antibody, Down syndrome cell adhesion molecule L homeolog antibody, DSCAM antibody, Dscam antibody, dscam antibody, dscama antibody, Dscam1 antibody, LOC5573626 antibody, CpipJ_CPIJ006173 antibody, dscam.L antibody
- Background
- DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.
- Molecular Weight
- 220 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-